PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100014530051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 262aa    MW: 29884.7 Da    PI: 9.9684
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100014530051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.51.3e-27114164151
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   k+r+rWt++LH+rF+++v++LGG++kAtPk il+lmk +gLt+ hvkSHLQ
  Ote100014530051|100014530051 114 KTRIRWTEDLHKRFIKCVDHLGGAKKATPKGILKLMKCDGLTIFHVKSHLQ 164
                                   68************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.586111171IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-23112164IPR009057Homeodomain-like
SuperFamilySSF466893.94E-14112165IPR009057Homeodomain-like
TIGRFAMsTIGR015579.7E-22114165IPR006447Myb domain, plants
PfamPF002492.9E-6118164IPR001005SANT/Myb domain
PfamPF143793.7E-18214260IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MFGSSFELQS LLLLSQKDIM QPQSRDTLQS LVQSCSCSNP CHEARLSSRG PHLHPHPSKL  60
VSERLRNEKN IDGIEGYCNR KSQLDKQFSS SGGTKLLAHS DAYAASEKDA MKQKTRIRWT  120
EDLHKRFIKC VDHLGGAKKA TPKGILKLMK CDGLTIFHVK SHLQVKKPKL LQFKCLICTF  180
RTNLLSFQKY RIAEVMPEAK EGNAELLGST TGAQIVEALR LQMDVQRRLY EQLESQKKLQ  240
MRIEEQAKQL QTMLECQLKT KE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLG9C2U84e-47G9C2U8_ORYPU; Putative Myb-like DNA-binding domain-containing protein
STRINGOB04G35670.11e-45(Oryza brachyantha)
STRINGSi022099m1e-45(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1671745